(data stored in ACNUC7421 zone)

EMBL: AP011115.GLTB

AP011115.GLTB        Location/Qualifiers
FT   CDS             complement(769627..774210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltB"
FT                   /locus_tag="ROP_07350"
FT                   /product="glutamate synthase large subunit"
FT                   /EC_number="1.4.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48982"
FT                   /db_xref="GOA:C1AT50"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT50"
FT                   /protein_id="BAH48982.1"
FT                   /translation="MLFSQLPGPQGLYDPDQEVDSCGVAMVADLHGRHSHAIVADGLLA
FT                   LENLEHRGAAGSEPNSGDGAGILLQLPTEFFGALAPFDLPAPLDDGSSTYAAGICFLPQ
FT                   DPQARAAAQRRVSDLADEEGLQILGWRPVPVDPDGADVGSTARACAPHMSQLFVAAPAV
FT                   GGIRPGGLALDRLVYPLRKRAEQVTPDIESEGSGVYFPSLSSRTIVYKGMLTTSQLARY
FT                   FPDLRDRRMASAIAIVHSRFSTNTFPSWPLAHPFRFVAHNGEINTVRGNRNRMRAREAL
FT                   LSSAVIPGDLSRLYPICTPDASDSASFDEVLELLHLAGRSVPHVVMMMVPEAWENDASM
FT                   CPDRRAFYQFHASLMEAWDGPACVTFTDGTVVGAVLDRNGLRPGRWWQTVDGRVVLASE
FT                   SGVLDVPQAEVVAKGRLEPGQMFLVDTSEGRIVPDEEIKMRLAAERPYAEWLYAGLLEL
FT                   KTLPDRPHAQHNHESVVRRQVAFGYTEEDLRILLAPMATSGGEPLGSMGTDTPIAVMSQ
FT                   RSRLLYDYFVELFAQVTNPPLDAIREEVVTSLSRVMGPEQNLLEPTAASCRQIVLPWPV
FT                   LDNEELNKIIHVNADGNHPGLAAAVLRALYDVERGGAGMAEAIEELRAQASAAIADGYR
FT                   TLVISDRDSDHTRAPIPSLLAVAAVHHHLVRTKERTKVALVVESGDAREVHHLALLIGY
FT                   GAAAVNPYLAMESIEDLVSEGELTGVEHTIAVRNYLTALGKGVLKVMSKMGISTVGSYT
FT                   AAQVFEAIGLDRDLVHEYFTGTVSKLGGAGLDEIAREVTVRHRQAYPDNPAEFAHRRLE
FT                   DGGEYQFRRDGELHLFTPETVFLLQHATRTGQHEVFAKYSEEVNRLAEAGGALRGLFTF
FT                   REGVRPPVPLDEVEPAERIVTRFNTGAMSYGSISAEAHETMAVAMNNLGGRSNSGEGGE
FT                   NVDRLYDPSRRSAVKQVASGRFGVTSDYLINASDIQIKMAQGAKPGEGGQLPAYKVYPW
FT                   VAETRHSTPGVGLISPPPHHDIYSIEDLAQLIHDLKNANDRARVHVKLVSSVGVGTVAA
FT                   GVSKAHADVVLISGNDGGTGATPLTSMKHAGAPWEIGLADAQQTLVLNGLRDRITIQCD
FT                   GGMRTGRDVVVAALLGAEEFGFSTAPLIVAGCIMMRVCHLDTCPVGVATQNPELRKRYT
FT                   GKPEFVEEFFRFVAEDVRRYLAELGFRSIDEAVGHADVLETAQGIAHWKNRGLDLTPIF
FT                   AVPAGPDGEPLPQRRRDRDQDHGLDRALDRTLIQLAEGALEDAHAVEIEMPVRNVNRTV
FT                   GTLLGAEVTRRYGAAGLPDDTIRLTFTGSAGQSLGAFLPPGITVDLTGDANDYVGKGLS
FT                   GGRIVVRPADDVLFVPETQVIAGNTLLYGATSGEVYLRGRVGERFSVRNSGASAVVEGV
FT                   GDHACEYMTGGRVVILGPTGRNLAAGMSGGIAYVLDLDPDDVNPAMVKLMQPDPDDLDW
FT                   LCGAVTRHHRWTGSAVAASVLADWPRRSALFTKVMPVDYQRVLDATRMAKAEGLDVDTA
FT                   IMEAARG"
     MLFSQLPGPQ GLYDPDQEVD SCGVAMVADL HGRHSHAIVA DGLLALENLE HRGAAGSEPN        60
     SGDGAGILLQ LPTEFFGALA PFDLPAPLDD GSSTYAAGIC FLPQDPQARA AAQRRVSDLA       120
     DEEGLQILGW RPVPVDPDGA DVGSTARACA PHMSQLFVAA PAVGGIRPGG LALDRLVYPL       180
     RKRAEQVTPD IESEGSGVYF PSLSSRTIVY KGMLTTSQLA RYFPDLRDRR MASAIAIVHS       240
     RFSTNTFPSW PLAHPFRFVA HNGEINTVRG NRNRMRAREA LLSSAVIPGD LSRLYPICTP       300
     DASDSASFDE VLELLHLAGR SVPHVVMMMV PEAWENDASM CPDRRAFYQF HASLMEAWDG       360
     PACVTFTDGT VVGAVLDRNG LRPGRWWQTV DGRVVLASES GVLDVPQAEV VAKGRLEPGQ       420
     MFLVDTSEGR IVPDEEIKMR LAAERPYAEW LYAGLLELKT LPDRPHAQHN HESVVRRQVA       480
     FGYTEEDLRI LLAPMATSGG EPLGSMGTDT PIAVMSQRSR LLYDYFVELF AQVTNPPLDA       540
     IREEVVTSLS RVMGPEQNLL EPTAASCRQI VLPWPVLDNE ELNKIIHVNA DGNHPGLAAA       600
     VLRALYDVER GGAGMAEAIE ELRAQASAAI ADGYRTLVIS DRDSDHTRAP IPSLLAVAAV       660
     HHHLVRTKER TKVALVVESG DAREVHHLAL LIGYGAAAVN PYLAMESIED LVSEGELTGV       720
     EHTIAVRNYL TALGKGVLKV MSKMGISTVG SYTAAQVFEA IGLDRDLVHE YFTGTVSKLG       780
     GAGLDEIARE VTVRHRQAYP DNPAEFAHRR LEDGGEYQFR RDGELHLFTP ETVFLLQHAT       840
     RTGQHEVFAK YSEEVNRLAE AGGALRGLFT FREGVRPPVP LDEVEPAERI VTRFNTGAMS       900
     YGSISAEAHE TMAVAMNNLG GRSNSGEGGE NVDRLYDPSR RSAVKQVASG RFGVTSDYLI       960
     NASDIQIKMA QGAKPGEGGQ LPAYKVYPWV AETRHSTPGV GLISPPPHHD IYSIEDLAQL      1020
     IHDLKNANDR ARVHVKLVSS VGVGTVAAGV SKAHADVVLI SGNDGGTGAT PLTSMKHAGA      1080
     PWEIGLADAQ QTLVLNGLRD RITIQCDGGM RTGRDVVVAA LLGAEEFGFS TAPLIVAGCI      1140
     MMRVCHLDTC PVGVATQNPE LRKRYTGKPE FVEEFFRFVA EDVRRYLAEL GFRSIDEAVG      1200
     HADVLETAQG IAHWKNRGLD LTPIFAVPAG PDGEPLPQRR RDRDQDHGLD RALDRTLIQL      1260
     AEGALEDAHA VEIEMPVRNV NRTVGTLLGA EVTRRYGAAG LPDDTIRLTF TGSAGQSLGA      1320
     FLPPGITVDL TGDANDYVGK GLSGGRIVVR PADDVLFVPE TQVIAGNTLL YGATSGEVYL      1380
     RGRVGERFSV RNSGASAVVE GVGDHACEYM TGGRVVILGP TGRNLAAGMS GGIAYVLDLD      1440
     PDDVNPAMVK LMQPDPDDLD WLCGAVTRHH RWTGSAVAAS VLADWPRRSA LFTKVMPVDY      1500
     QRVLDATRMA KAEGLDVDTA IMEAARG                                          1527
//

If you have problems or comments...

PBIL Back to PBIL home page