(data stored in ACNUC7421 zone)

EMBL: AP011115.GLTD

AP011115.GLTD        Location/Qualifiers
FT   CDS             complement(768132..769634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltD"
FT                   /locus_tag="ROP_07340"
FT                   /product="glutamate synthase small subunit"
FT                   /EC_number="1.4.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48981"
FT                   /db_xref="GOA:C1AT49"
FT                   /db_xref="InterPro:IPR006005"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT49"
FT                   /protein_id="BAH48981.1"
FT                   /translation="MADPQGFLHIVKKEAPKRPIAERIHDWNEVYAPQSSAERAAEVSE
FT                   QAARCMDCGIPFCHSGSAGCPLGNLIPEWNDLVRRGRWSAASERLHATNNFPEFTGRVC
FT                   PAPCESACVLSLADTHTTGSVTIKRIEQAIADVAWDSGTVVPKPPMIATGRKVAVVGSG
FT                   PAGLAAAQQLTRAGHDVTVYERDDRLGGLLRYGIPEFKMEKAILDQRLMQMRAEGTHFV
FT                   TDCEVGVDLTVEQMRENFDAVVLAIGALRARDNTTVEGRELNGIHLAMEHLVTSNKECE
FT                   GDGPATITAKGKHVVIIGGGDTGADCLGTAHRQGALSVTQLDYNPELPTERDEAATPWP
FT                   AWPMVLRTSPAHAEGGVRRYQVAVQRFLGDANGNVRSMVLAEVEVAREDGKRIITPVGE
FT                   EIELPCELALFAIGFEGVDLGPLLDDYGLSPTRRGALSCGPDWQTTAPGVFVCGDAHRG
FT                   ASLVVWAIAEGRSAAHAVDVYLTGASDLPSPVHPTALPLAVV"
     MADPQGFLHI VKKEAPKRPI AERIHDWNEV YAPQSSAERA AEVSEQAARC MDCGIPFCHS        60
     GSAGCPLGNL IPEWNDLVRR GRWSAASERL HATNNFPEFT GRVCPAPCES ACVLSLADTH       120
     TTGSVTIKRI EQAIADVAWD SGTVVPKPPM IATGRKVAVV GSGPAGLAAA QQLTRAGHDV       180
     TVYERDDRLG GLLRYGIPEF KMEKAILDQR LMQMRAEGTH FVTDCEVGVD LTVEQMRENF       240
     DAVVLAIGAL RARDNTTVEG RELNGIHLAM EHLVTSNKEC EGDGPATITA KGKHVVIIGG       300
     GDTGADCLGT AHRQGALSVT QLDYNPELPT ERDEAATPWP AWPMVLRTSP AHAEGGVRRY       360
     QVAVQRFLGD ANGNVRSMVL AEVEVAREDG KRIITPVGEE IELPCELALF AIGFEGVDLG       420
     PLLDDYGLSP TRRGALSCGP DWQTTAPGVF VCGDAHRGAS LVVWAIAEGR SAAHAVDVYL       480
     TGASDLPSPV HPTALPLAVV                                                   500
//

If you have problems or comments...

PBIL Back to PBIL home page