(data stored in ACNUC7421 zone)

EMBL: AP011115.GRPE

AP011115.GRPE        Location/Qualifiers
FT   CDS             138841..139632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="ROP_01560"
FT                   /product="GrpE protein"
FT                   /note="protein synonym:nucleotide exchange factor"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01560"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48403"
FT                   /db_xref="GOA:C1ASF4"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASF4"
FT                   /protein_id="BAH48403.1"
FT                   /translation="MNTPYDEQQRSGTAGRGRGNGRQPPREPIAITDRRRIDPVTGRVR
FT                   QDTPGSHSPQDRGASTLSGKASPGEKAGTSSLDTGAARPEPRQVDSDRVAELTADLQRL
FT                   QAEYANYRRRVERDRAAAAENAKASVVAEFLGVLDDLDWAREHGDTAREPRHSLSRKIR
FT                   TILARMGVAAFGERGDRFDPTLHEAASHDGHGTDLVVDTVLRRGYTFGVHTVLRTALVT
FT                   VIDRDRYENTSNPGPPADTDARPESGGAGDPGDDPNPYRCG"
     MNTPYDEQQR SGTAGRGRGN GRQPPREPIA ITDRRRIDPV TGRVRQDTPG SHSPQDRGAS        60
     TLSGKASPGE KAGTSSLDTG AARPEPRQVD SDRVAELTAD LQRLQAEYAN YRRRVERDRA       120
     AAAENAKASV VAEFLGVLDD LDWAREHGDT AREPRHSLSR KIRTILARMG VAAFGERGDR       180
     FDPTLHEAAS HDGHGTDLVV DTVLRRGYTF GVHTVLRTAL VTVIDRDRYE NTSNPGPPAD       240
     TDARPESGGA GDPGDDPNPY RCG                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page