(data stored in ACNUC7421 zone)

EMBL: AP011115.GVPA

AP011115.GVPA        Location/Qualifiers
FT   CDS             346434..346844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gvpA"
FT                   /locus_tag="ROP_03300"
FT                   /product="putative gas vesicle structural protein GvpA"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48577"
FT                   /db_xref="GOA:C1ARA0"
FT                   /db_xref="InterPro:IPR000638"
FT                   /db_xref="InterPro:IPR018493"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARA0"
FT                   /protein_id="BAH48577.1"
FT                   /translation="MTAIQPAGGGGGVSGGPSSSSLADVIDTILDKGLVIDAYVRVSLV
FT                   GIELLTIDARVVVASVDTYLRFAEAVNRLEIGSGEPKGLTDLVGSVTEGGAKSKTKGAL
FT                   EAAGDKLGDILGGGQEEPERERVSRKSSRGDK"
     MTAIQPAGGG GGVSGGPSSS SLADVIDTIL DKGLVIDAYV RVSLVGIELL TIDARVVVAS        60
     VDTYLRFAEA VNRLEIGSGE PKGLTDLVGS VTEGGAKSKT KGALEAAGDK LGDILGGGQE       120
     EPERERVSRK SSRGDK                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page