(data stored in ACNUC7421 zone)

EMBL: AP011115.GVPJ

AP011115.GVPJ        Location/Qualifiers
FT   CDS             348181..348588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gvpJ"
FT                   /locus_tag="ROP_03340"
FT                   /product="putative gas vesicle synthesis protein GvpJ"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48581"
FT                   /db_xref="GOA:C1ARA4"
FT                   /db_xref="InterPro:IPR000638"
FT                   /db_xref="InterPro:IPR018493"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARA4"
FT                   /protein_id="BAH48581.1"
FT                   /translation="MTVVGGGASNLPQSSGGGFGGGHQSTNLGEILERVLDKGLVIAGD
FT                   IQVNLLDIELLTIKVRLVIASLETAKEVGIDWWEHDPWLTGKNSDVELENRKLRERIAE
FT                   LESDRSVRPAVEDADTVEVEASRQERDDDRR"
     MTVVGGGASN LPQSSGGGFG GGHQSTNLGE ILERVLDKGL VIAGDIQVNL LDIELLTIKV        60
     RLVIASLETA KEVGIDWWEH DPWLTGKNSD VELENRKLRE RIAELESDRS VRPAVEDADT       120
     VEVEASRQER DDDRR                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page