(data stored in ACNUC7421 zone)

EMBL: AP011115.GVPK

AP011115.GVPK        Location/Qualifiers
FT   CDS             349560..349892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gvpK"
FT                   /locus_tag="ROP_03370"
FT                   /product="putative gas vesicle synthesis protein GvpK"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48584"
FT                   /db_xref="GOA:C1ARA7"
FT                   /db_xref="InterPro:IPR007805"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARA7"
FT                   /protein_id="BAH48584.1"
FT                   /translation="MAESEPADSDAPSEIGRRVLPQRIDADPESVEKGLVTLVLTIVEL
FT                   LRQLMERQALRRVEHGDLTDDQIERIGTTLMLLEERMAELRDHFDLTPEDLNIDLGPLG
FT                   PLLSNE"
     MAESEPADSD APSEIGRRVL PQRIDADPES VEKGLVTLVL TIVELLRQLM ERQALRRVEH        60
     GDLTDDQIER IGTTLMLLEE RMAELRDHFD LTPEDLNIDL GPLGPLLSNE                  110
//

If you have problems or comments...

PBIL Back to PBIL home page