(data stored in ACNUC7421 zone)

EMBL: AP011115.GVPL

AP011115.GVPL        Location/Qualifiers
FT   CDS             348575..349354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gvpL"
FT                   /locus_tag="ROP_03350"
FT                   /product="putative gas vesicle synthesis protein GvpL"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48582"
FT                   /db_xref="GOA:C1ARA5"
FT                   /db_xref="InterPro:IPR009430"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARA5"
FT                   /protein_id="BAH48582.1"
FT                   /translation="MTADDGVWLYSITTDSVDDAQLAEVTGVAGEPVRAVASAGLVAVV
FT                   GTVSLSEFGQEPLQRKLEDLDWLAATARAHDAVVAAVTRRGPTVPLRLATLYLDDDRVR
FT                   VLLTERREEFGATLRRVTGRSEWGVKGYGDAKILSQDVKEEPSPTGAAGKGTAYLLRRR
FT                   AELSAQQDVERKAADHAGEIHAALLEQAVDGLRRQVTDPVLTGKRAWMIFNGTYLVDND
FT                   RIEGFAALVTALDTERPGITLELTGPWPPYSFAGIDG"
     MTADDGVWLY SITTDSVDDA QLAEVTGVAG EPVRAVASAG LVAVVGTVSL SEFGQEPLQR        60
     KLEDLDWLAA TARAHDAVVA AVTRRGPTVP LRLATLYLDD DRVRVLLTER REEFGATLRR       120
     VTGRSEWGVK GYGDAKILSQ DVKEEPSPTG AAGKGTAYLL RRRAELSAQQ DVERKAADHA       180
     GEIHAALLEQ AVDGLRRQVT DPVLTGKRAW MIFNGTYLVD NDRIEGFAAL VTALDTERPG       240
     ITLELTGPWP PYSFAGIDG                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page