(data stored in ACNUC7421 zone)

EMBL: AP011115.GVPO

AP011115.GVPO        Location/Qualifiers
FT   CDS             347894..348184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gvpO"
FT                   /locus_tag="ROP_03330"
FT                   /product="putative gas vesicle synthesis protein GvpO"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48580"
FT                   /db_xref="GOA:C1ARA3"
FT                   /db_xref="InterPro:IPR008634"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARA3"
FT                   /protein_id="BAH48580.1"
FT                   /translation="MAEEEPPPLPAPEIAEIATRDVAKLTGKKPLGATSVMPTDDGWTV
FT                   EVEVVEDRRIPSSTDMLALYEVVLDLDGELLSYRRTRRYIRGVGDSGSAQS"
     MAEEEPPPLP APEIAEIATR DVAKLTGKKP LGATSVMPTD DGWTVEVEVV EDRRIPSSTD        60
     MLALYEVVLD LDGELLSYRR TRRYIRGVGD SGSAQS                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page