(data stored in ACNUC7421 zone)

EMBL: AP011115.HISF

AP011115.HISF        Location/Qualifiers
FT   CDS             complement(784319..785092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /locus_tag="ROP_07480"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   HisF"
FT                   /EC_number="4.1.3.-"
FT                   /note="protein synonym:IGP synthase cyclase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48995"
FT                   /db_xref="GOA:C1ATY7"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1ATY7"
FT                   /protein_id="BAH48995.1"
FT                   /translation="MTLAVRVIPCLDVDAGRVVKGVNFENLRDAGDPVELAAAYDAQGA
FT                   DELTFLDVTASTADRGTMLDVVSRTAEQVFIPLTVGGGVRTVEDVDRLLRAGADKVSVN
FT                   TAAIARPELLRELSERFGSQCIVLSVDARTVPQGQPDTPSGWEVTTHGGKRGTGIDAVE
FT                   WAVRGAELGVGEILLNSMDADGTKAGFDLPMIRAVRAAVHVPVIASGGAGAVEHFAPAV
FT                   GAGADAVLAASVFHFGDMTIGDVKKSMRAEGITVR"
     MTLAVRVIPC LDVDAGRVVK GVNFENLRDA GDPVELAAAY DAQGADELTF LDVTASTADR        60
     GTMLDVVSRT AEQVFIPLTV GGGVRTVEDV DRLLRAGADK VSVNTAAIAR PELLRELSER       120
     FGSQCIVLSV DARTVPQGQP DTPSGWEVTT HGGKRGTGID AVEWAVRGAE LGVGEILLNS       180
     MDADGTKAGF DLPMIRAVRA AVHVPVIASG GAGAVEHFAP AVGAGADAVL AASVFHFGDM       240
     TIGDVKKSMR AEGITVR                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page