(data stored in ACNUC7421 zone)

EMBL: AP011115.HMUT

AP011115.HMUT        Location/Qualifiers
FT   CDS             643122..644162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmuT"
FT                   /locus_tag="ROP_06200"
FT                   /product="putative hemin ABC transporter hemin-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48867"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:C1AST5"
FT                   /protein_id="BAH48867.1"
FT                   /translation="MKSMFRAFTNRSLFAVLVLLLVSVVAVSACSSGAGDNAGGTGGAR
FT                   TAVLDDLNPEPLASAATPALPVTVRSFDGVDVTITDASRIVTADRYGTLTETVFALGLG
FT                   DNVVGRDIASEFPAAQHVPVVTPGGQSLNAEAILDLAPTVILTDTSIGPQAVQDQLRAA
FT                   GVPVVYFDPTRTLDGVPGQITAVANALGVPEQGRELADRTENEIAAARSRAPEGENPLK
FT                   IAFLYLRGTAITMIGGPGSGADSLIDALGAVDAGTASGITQQFAPITSEALIAAAPDVL
FT                   LLMTGGLESIGGIEGLEKIPGVAQTPAGRNQRVVDMQDGVLLSFGPNTGRVLGALADAV
FT                   YPAATR"
     MKSMFRAFTN RSLFAVLVLL LVSVVAVSAC SSGAGDNAGG TGGARTAVLD DLNPEPLASA        60
     ATPALPVTVR SFDGVDVTIT DASRIVTADR YGTLTETVFA LGLGDNVVGR DIASEFPAAQ       120
     HVPVVTPGGQ SLNAEAILDL APTVILTDTS IGPQAVQDQL RAAGVPVVYF DPTRTLDGVP       180
     GQITAVANAL GVPEQGRELA DRTENEIAAA RSRAPEGENP LKIAFLYLRG TAITMIGGPG       240
     SGADSLIDAL GAVDAGTASG ITQQFAPITS EALIAAAPDV LLLMTGGLES IGGIEGLEKI       300
     PGVAQTPAGR NQRVVDMQDG VLLSFGPNTG RVLGALADAV YPAATR                      346
//

If you have problems or comments...

PBIL Back to PBIL home page