(data stored in ACNUC7421 zone)

EMBL: AP011115.HMUU

AP011115.HMUU        Location/Qualifiers
FT   CDS             644159..645229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmuU"
FT                   /locus_tag="ROP_06210"
FT                   /product="putative hemin ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48868"
FT                   /db_xref="GOA:C1AST6"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C1AST6"
FT                   /protein_id="BAH48868.1"
FT                   /translation="MTVEDLDAPGKSSPRTRTGAVLGGLLIALAVAAVFSACIGQVPTG
FT                   PGEVVGSILHRIGLDLGPMPAHPSGEVTLWEVRFPRVVLAILVGAALGCAGALLQGVFA
FT                   NPLAEPGVIGVSAGAAVGASAAIVVGAFAAGWTVAGAAFVAGLVTTVAVYLLARHEGRT
FT                   EVVTLVLTGVAVNAFAGGLIAFFTFVASPAARDQIVFWQLGSLNGATWSAVAVVAPMTV
FT                   AGIAATMMIAGKLDLLSLGENAARHLGLDVERLRQIAVLIVALLVSSSVAFTGIILFVG
FT                   LVVPHLMRIAVGPGHRALIPASALCGSLVLLLADLGARSLVANADLPLGMLTALVGGPF
FT                   FFWLLRRTRASQGGWA"
     MTVEDLDAPG KSSPRTRTGA VLGGLLIALA VAAVFSACIG QVPTGPGEVV GSILHRIGLD        60
     LGPMPAHPSG EVTLWEVRFP RVVLAILVGA ALGCAGALLQ GVFANPLAEP GVIGVSAGAA       120
     VGASAAIVVG AFAAGWTVAG AAFVAGLVTT VAVYLLARHE GRTEVVTLVL TGVAVNAFAG       180
     GLIAFFTFVA SPAARDQIVF WQLGSLNGAT WSAVAVVAPM TVAGIAATMM IAGKLDLLSL       240
     GENAARHLGL DVERLRQIAV LIVALLVSSS VAFTGIILFV GLVVPHLMRI AVGPGHRALI       300
     PASALCGSLV LLLADLGARS LVANADLPLG MLTALVGGPF FFWLLRRTRA SQGGWA           356
//

If you have problems or comments...

PBIL Back to PBIL home page