(data stored in ACNUC7421 zone)

EMBL: AP011115.HMUV

AP011115.HMUV        Location/Qualifiers
FT   CDS             645226..646104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmuV"
FT                   /locus_tag="ROP_06220"
FT                   /product="putative hemin ABC transporter ATP-binding
FT                   protein"
FT                   /EC_number="3.6.3.34"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48869"
FT                   /db_xref="GOA:C1AST7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015863"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1AST7"
FT                   /protein_id="BAH48869.1"
FT                   /translation="MSPSFHPLRTRVGEALDQNLFRRTDPVPPPRPSGAVTLRAEGIAV
FT                   TRGGRPVLDDVSVDVRIGEVLVLVGPNGAGKSTLLAALSGDQDVHAGSVELDDRDLGEW
FT                   TALEMAQRRAVLPQQNTVGFSFTARQVITMGRSPWARTPRSDDDAAAIAEAVRICDVVA
FT                   FADRPFTALSGGERARVALARVLAQRTETILLDEPTAALDLGHQETVMRLARSRAEQGT
FT                   AVVVVLHDLALAAAYADRIVVLEQGRVAADGPPRDVLSEGLLTRVYGHPVEVIAHPVTG
FT                   ATLVLPRRDHR"
     MSPSFHPLRT RVGEALDQNL FRRTDPVPPP RPSGAVTLRA EGIAVTRGGR PVLDDVSVDV        60
     RIGEVLVLVG PNGAGKSTLL AALSGDQDVH AGSVELDDRD LGEWTALEMA QRRAVLPQQN       120
     TVGFSFTARQ VITMGRSPWA RTPRSDDDAA AIAEAVRICD VVAFADRPFT ALSGGERARV       180
     ALARVLAQRT ETILLDEPTA ALDLGHQETV MRLARSRAEQ GTAVVVVLHD LALAAAYADR       240
     IVVLEQGRVA ADGPPRDVLS EGLLTRVYGH PVEVIAHPVT GATLVLPRRD HR               292
//

If you have problems or comments...

PBIL Back to PBIL home page