(data stored in ACNUC7421 zone)

EMBL: AP011115.HSP18

AP011115.HSP18       Location/Qualifiers
FT   CDS             144915..145340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsp18"
FT                   /locus_tag="ROP_01650"
FT                   /product="putative heat shock protein Hsp18"
FT                   /note="protein synonym:18-kDa antigen"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01650"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48412"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASG3"
FT                   /protein_id="BAH48412.1"
FT                   /translation="MLMRTDPFRDLDRLTQQIFGTAARPAVMPMDAWREEDRFVVEFDL
FT                   PGVNADSLDLDVEKNTLTVHAERAALNENREMVAAERPRGVFSRQLFLGENLDVDKIEA
FT                   NYDAGVLRLTIPIAEKAKPRKIEISSNGHSEQKAVNA"
     MLMRTDPFRD LDRLTQQIFG TAARPAVMPM DAWREEDRFV VEFDLPGVNA DSLDLDVEKN        60
     TLTVHAERAA LNENREMVAA ERPRGVFSRQ LFLGENLDVD KIEANYDAGV LRLTIPIAEK       120
     AKPRKIEISS NGHSEQKAVN A                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page