(data stored in ACNUC7421 zone)

EMBL: AP011115.MAP

AP011115.MAP         Location/Qualifiers
FT   CDS             458994..459779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="ROP_04500"
FT                   /product="methionine aminopeptidase"
FT                   /EC_number="3.4.11.18"
FT                   /note="protein synonym:peptidase M"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04500"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48697"
FT                   /db_xref="GOA:C1ARM0"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARM0"
FT                   /protein_id="BAH48697.1"
FT                   /translation="MEDERVLELKTPREIEAMRTTGAFIAELLDDLQSRAAVGVNLLDL
FT                   EHRARHLIKDRGAVSCYWDYAPSFGRGPFHNVICLSVNDAVLHGLPHDYTLRDGDLLSM
FT                   DIAVSIDGWVADSARSLIVGTPHAGDQRLIEATERALDAGIDAARPGRRLGDISAAIGA
FT                   VATDYGFPVNTEFGGHGLGRTMHEDPHVSNQGRAGRGLVLRPGLTLALEPWFARGTDKI
FT                   VYDPDGWTIRSADGSRTAHSEHTIAITDGDPLVLTRRSA"
     MEDERVLELK TPREIEAMRT TGAFIAELLD DLQSRAAVGV NLLDLEHRAR HLIKDRGAVS        60
     CYWDYAPSFG RGPFHNVICL SVNDAVLHGL PHDYTLRDGD LLSMDIAVSI DGWVADSARS       120
     LIVGTPHAGD QRLIEATERA LDAGIDAARP GRRLGDISAA IGAVATDYGF PVNTEFGGHG       180
     LGRTMHEDPH VSNQGRAGRG LVLRPGLTLA LEPWFARGTD KIVYDPDGWT IRSADGSRTA       240
     HSEHTIAITD GDPLVLTRRS A                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page