(data stored in ACNUC7421 zone)

EMBL: AP011115.METH

AP011115.METH        Location/Qualifiers
FT   CDS             complement(613327..616896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metH"
FT                   /locus_tag="ROP_05970"
FT                   /product="methionine synthase"
FT                   /EC_number="2.1.1.13"
FT                   /note="protein synonym:5-methyltetrahydrofolate--
FT                   homocysteine methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05970"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48844"
FT                   /db_xref="GOA:C1ASR2"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASR2"
FT                   /protein_id="BAH48844.1"
FT                   /translation="MSAPFHSALLDALNQRVVIGDGAMGTMLQAADLTLDDFLGLEGCN
FT                   EILNDTRPDVLKEIHRAYFEAGADAVETNTFGCNLPNLADYDISDRIRELAEKGTRLAR
FT                   EVADEMGPGRDGMGRFVLGSMGPGTKLPTLGHAPFAILRDAYAEAAMGMIDGGADAILV
FT                   ETCQDLLQVKAAILGSQRAMETLGSRLPIITHVTVETTGTMLLGSEIGAALTALEPLGI
FT                   DMIGLNCATGPAEMSEHLRHLSKYSSLPVSVMPNAGLPQLGPNGAEYPLTAEELAEALS
FT                   GFVTEFGLGLVGGCCGTTPEHIRQVADAVRLVEKAARNPVHESGTSSLYTAVPFEQDAS
FT                   ILMIGERTNSNGSKAFREAMIAEDYQKCLDIAKDQTRDGAHMLDLNVDYVGRDGAADMA
FT                   ALASRFATSSTLPIMLDSTEPAVLQAGLEHLGGRCAVNSVNYEDGDGPDSRFQKIMRLV
FT                   KEHGAAVVALTIDEEGQARTAEHKVRIAERLLEDITVNWGLDESDIIIDALTFPISTGQ
FT                   EEVRRDGIETIEAIRELKKRHPRVHFTLGVSNISFGLNPAARQVLNSVFLHECTEAGLD
FT                   TAIVHASKILPMARIPDEQRETALDLVYDRRREGYDPLQKLMELFEGVSAASARESRAQ
FT                   ELAALPLFERLERRIVDGERNGLDDDLTAAMEEKPPLAIINETLLSGMKTVGELFGSGQ
FT                   MQLPFVLQSAEVMKAAVAYLEPHMEATDEDGKGRIVIATVKGDVHDIGKNLVDIILSNN
FT                   GYDVVNLGIKQPIATILDAAIEQKADVIGMSGLLVKSTVVMKDNLQELNAKGVAEKFPV
FT                   LLGGAALTRSYVENDLAEVYEGDVSYARDAFEGLHKMDEIMAVKRGGAPDPDSPEAIAA
FT                   REKAAERKARHERSKRIAEKRKAAEVPVELPERSDVATDIAVPSPPFWGNRIVKGVSLS
FT                   DYSGLLDERALFLGQWGLRGQRSGDGPTYEELVETEGRPRLRYWLDRLSTEGILAHAAV
FT                   VYGYFPAVSEGDDVVVLTDPTPDAEERFRFTFPRQHRDRFLCVADFVRSRTEAKETGQV
FT                   DVFPMQLVTMGQPIADFANELFAANAYRDYLEVHGIGVQLTESLAEYWHQRVREELVLP
FT                   GGHNVGEQDPSEVSGFFDLAYRGARYSFGYGACPNLEDRAKMVALLEPERIGVKLSEEL
FT                   QLHPEQSTDAFVLHHPEAKYFNV"
     MSAPFHSALL DALNQRVVIG DGAMGTMLQA ADLTLDDFLG LEGCNEILND TRPDVLKEIH        60
     RAYFEAGADA VETNTFGCNL PNLADYDISD RIRELAEKGT RLAREVADEM GPGRDGMGRF       120
     VLGSMGPGTK LPTLGHAPFA ILRDAYAEAA MGMIDGGADA ILVETCQDLL QVKAAILGSQ       180
     RAMETLGSRL PIITHVTVET TGTMLLGSEI GAALTALEPL GIDMIGLNCA TGPAEMSEHL       240
     RHLSKYSSLP VSVMPNAGLP QLGPNGAEYP LTAEELAEAL SGFVTEFGLG LVGGCCGTTP       300
     EHIRQVADAV RLVEKAARNP VHESGTSSLY TAVPFEQDAS ILMIGERTNS NGSKAFREAM       360
     IAEDYQKCLD IAKDQTRDGA HMLDLNVDYV GRDGAADMAA LASRFATSST LPIMLDSTEP       420
     AVLQAGLEHL GGRCAVNSVN YEDGDGPDSR FQKIMRLVKE HGAAVVALTI DEEGQARTAE       480
     HKVRIAERLL EDITVNWGLD ESDIIIDALT FPISTGQEEV RRDGIETIEA IRELKKRHPR       540
     VHFTLGVSNI SFGLNPAARQ VLNSVFLHEC TEAGLDTAIV HASKILPMAR IPDEQRETAL       600
     DLVYDRRREG YDPLQKLMEL FEGVSAASAR ESRAQELAAL PLFERLERRI VDGERNGLDD       660
     DLTAAMEEKP PLAIINETLL SGMKTVGELF GSGQMQLPFV LQSAEVMKAA VAYLEPHMEA       720
     TDEDGKGRIV IATVKGDVHD IGKNLVDIIL SNNGYDVVNL GIKQPIATIL DAAIEQKADV       780
     IGMSGLLVKS TVVMKDNLQE LNAKGVAEKF PVLLGGAALT RSYVENDLAE VYEGDVSYAR       840
     DAFEGLHKMD EIMAVKRGGA PDPDSPEAIA AREKAAERKA RHERSKRIAE KRKAAEVPVE       900
     LPERSDVATD IAVPSPPFWG NRIVKGVSLS DYSGLLDERA LFLGQWGLRG QRSGDGPTYE       960
     ELVETEGRPR LRYWLDRLST EGILAHAAVV YGYFPAVSEG DDVVVLTDPT PDAEERFRFT      1020
     FPRQHRDRFL CVADFVRSRT EAKETGQVDV FPMQLVTMGQ PIADFANELF AANAYRDYLE      1080
     VHGIGVQLTE SLAEYWHQRV REELVLPGGH NVGEQDPSEV SGFFDLAYRG ARYSFGYGAC      1140
     PNLEDRAKMV ALLEPERIGV KLSEELQLHP EQSTDAFVLH HPEAKYFNV                  1189
//

If you have problems or comments...

PBIL Back to PBIL home page