(data stored in ACNUC7421 zone)

EMBL: AP011115.MREB

AP011115.MREB        Location/Qualifiers
FT   CDS             389673..390662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreB"
FT                   /locus_tag="ROP_03780"
FT                   /product="putative rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03780"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48625"
FT                   /db_xref="GOA:C1ARE8"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARE8"
FT                   /protein_id="BAH48625.1"
FT                   /translation="MGGLGIDLGTANTVVGTPDDGIVLNEPSFMLVRTKEPHRALAIGS
FT                   EARSLVGRTPIGITPVRPLRDGVIVDLESARAFVTAIVKRVSPARRYGVRPKAVISVPA
FT                   GATPLERRALLEVGHEAGLRKVGLVPEPVAGALGCGINPLEPRAHLVVDIGGGTSEITA
FT                   ICFGGILSHRSCRLAGDELTNALYQYLRAEHNIVVGELTAERAKLGAPDTDEGQSLVVE
FT                   GRDAVTGRARFVTLETEEIVDALRPTTTGIVHTLTECLEDLPPQAIGDVMSEGLLVIGG
FT                   GALLRGLSQLLEEAFGFPVKTAERPLTCVAEGATACLVHPEVVAAYSS"
     MGGLGIDLGT ANTVVGTPDD GIVLNEPSFM LVRTKEPHRA LAIGSEARSL VGRTPIGITP        60
     VRPLRDGVIV DLESARAFVT AIVKRVSPAR RYGVRPKAVI SVPAGATPLE RRALLEVGHE       120
     AGLRKVGLVP EPVAGALGCG INPLEPRAHL VVDIGGGTSE ITAICFGGIL SHRSCRLAGD       180
     ELTNALYQYL RAEHNIVVGE LTAERAKLGA PDTDEGQSLV VEGRDAVTGR ARFVTLETEE       240
     IVDALRPTTT GIVHTLTECL EDLPPQAIGD VMSEGLLVIG GGALLRGLSQ LLEEAFGFPV       300
     KTAERPLTCV AEGATACLVH PEVVAAYSS                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page