(data stored in ACNUC7421 zone)

EMBL: AP011115.NASD

AP011115.NASD        Location/Qualifiers
FT   CDS             619449..621614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasD"
FT                   /locus_tag="ROP_06000"
FT                   /product="nitrite reductase large subunit"
FT                   /EC_number="1.7.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06000"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48847"
FT                   /db_xref="GOA:C1ASR5"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASR5"
FT                   /protein_id="BAH48847.1"
FT                   /translation="MLIVATGSNTFFPNMDGLREHDGRLARGVFGFRNIADTNGMLQMA
FT                   QAHDDVSAVVIGGGLLGLEAAYGLRTQGLTVDVVHSPGHLMNQQLDERGGSVLRAEIEK
FT                   LGVGVHTSMRTTAVLRDDAGLVTGVSFVDGSTLDADMVVVTAGIRPNTELARAAGLVVE
FT                   RGIVVDDQMRCEDEGSVYAVGECAQHRGETYGLVAPVWEQAVILADVLTGSDPEAAYVG
FT                   SRTTTQLKVAGVDVAAMGVKGPETADDEFVQYYEPRSGTYKSLVVRDGKLIGATLMGDI
FT                   SKAGFLTQAFDGKVPLPEERISMLFDVGTPAAATSVADLPDDLQVCNCNGVSKGDLVAC
FT                   VHSGAKTLTDVCATTRAGKGCGSCKGLVADIVACAAGGELEADPSADWYVPCIPMSKPE
FT                   LTAAIRERDLRAVSQVFAELATDANEDASAKMPLASLLRTIWGPDWVDERGALFINDRV
FT                   HANIQRDGTFSVVPQMKGGVTTPDQLRRIADVADKYRVPLVKVTGGQRIDLLGIKKEDL
FT                   PKVWGDLDMPSGFAYGKSMRTVKTCVGTDFCRYGLGDSTSLGIALEERFQGLETPAKLK
FT                   LAVAGCPRNCSEALCKDFGVVAVGDGRWEIYVGGAAGAHIRKGDLLATVESPDAVVELG
FT                   GRFIQYYRENAKWLERTYDFVPRVGLEHLQALLVRDEEDIVTGLDERIQTAVDGYRDPW
FT                   KERSAPKSPAQFAPSLPLLPLPQVPVR"
     MLIVATGSNT FFPNMDGLRE HDGRLARGVF GFRNIADTNG MLQMAQAHDD VSAVVIGGGL        60
     LGLEAAYGLR TQGLTVDVVH SPGHLMNQQL DERGGSVLRA EIEKLGVGVH TSMRTTAVLR       120
     DDAGLVTGVS FVDGSTLDAD MVVVTAGIRP NTELARAAGL VVERGIVVDD QMRCEDEGSV       180
     YAVGECAQHR GETYGLVAPV WEQAVILADV LTGSDPEAAY VGSRTTTQLK VAGVDVAAMG       240
     VKGPETADDE FVQYYEPRSG TYKSLVVRDG KLIGATLMGD ISKAGFLTQA FDGKVPLPEE       300
     RISMLFDVGT PAAATSVADL PDDLQVCNCN GVSKGDLVAC VHSGAKTLTD VCATTRAGKG       360
     CGSCKGLVAD IVACAAGGEL EADPSADWYV PCIPMSKPEL TAAIRERDLR AVSQVFAELA       420
     TDANEDASAK MPLASLLRTI WGPDWVDERG ALFINDRVHA NIQRDGTFSV VPQMKGGVTT       480
     PDQLRRIADV ADKYRVPLVK VTGGQRIDLL GIKKEDLPKV WGDLDMPSGF AYGKSMRTVK       540
     TCVGTDFCRY GLGDSTSLGI ALEERFQGLE TPAKLKLAVA GCPRNCSEAL CKDFGVVAVG       600
     DGRWEIYVGG AAGAHIRKGD LLATVESPDA VVELGGRFIQ YYRENAKWLE RTYDFVPRVG       660
     LEHLQALLVR DEEDIVTGLD ERIQTAVDGY RDPWKERSAP KSPAQFAPSL PLLPLPQVPV       720
     R                                                                       721
//

If you have problems or comments...

PBIL Back to PBIL home page