(data stored in ACNUC7421 zone)

EMBL: AP011115.NASE

AP011115.NASE        Location/Qualifiers
FT   CDS             621611..621937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasE"
FT                   /locus_tag="ROP_06010"
FT                   /product="nitrite reductase small subunit"
FT                   /EC_number="1.7.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48848"
FT                   /db_xref="GOA:C1ASR6"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASR6"
FT                   /protein_id="BAH48848.1"
FT                   /translation="MTALIEGPTEFAVGPVSDLTPGEGRTYVVQDRQVAVFLLSDGTVR
FT                   AMDAVCPHRGGPLADGQIDASGVMCPLHQYAFAFDTGACGSEGVGSVRTYPASVREGSV
FT                   VVHV"
     MTALIEGPTE FAVGPVSDLT PGEGRTYVVQ DRQVAVFLLS DGTVRAMDAV CPHRGGPLAD        60
     GQIDASGVMC PLHQYAFAFD TGACGSEGVG SVRTYPASVR EGSVVVHV                    108
//

If you have problems or comments...

PBIL Back to PBIL home page