(data stored in ACNUC7421 zone)

EMBL: AP011115.OTSA

AP011115.OTSA        Location/Qualifiers
FT   CDS             186019..187461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="otsA"
FT                   /locus_tag="ROP_02140"
FT                   /product="putative alpha,alpha-trehalose-phosphate
FT                   synthase"
FT                   /EC_number="2.4.1.15"
FT                   /note="protein synonym:trehalose-6-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48461"
FT                   /db_xref="GOA:C1ASL2"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASL2"
FT                   /protein_id="BAH48461.1"
FT                   /translation="MNDSAPHGTSDFVVVANRLPVDMETLDDGTTRWKRSPGGLVTALE
FT                   PILLGRERGSWVGWPGVPDTKVEPIVSGGVDLFPVELSSDEVARYYEGFSNATLWPLYH
FT                   DVLVAPVFDRDWWHTYLEVNRHFAEETARTAAEGATVWVQDYQLQLVPRLLREMRPDLT
FT                   IGFFLHIPFPPVELFMQLPWRKEIVEGLLGADLIGFHLPGGAHNFLFLARRLLGLDATT
FT                   AGVGVRGALGTVTLDDRVVHVGAFPISVDARKLVEQATEPAVVERAAEIRRELGNPRKI
FT                   LLGVDRLDYTKGIDLRLSALGELLDEGRLDPSDTVMVQLATPSRERVEHYMKMRSSIEE
FT                   QVSHINGDHGQIGRPVVHYLYQPVDRSELIALFLAADVMLVTPMRDGMNLVAKEYVACR
FT                   ADLGGALVLSEFAGAAAELRGAYLVNPHDLDGVKNTIVAALGQEREQGRRRMSRLHRQV
FT                   LDHDVHRWAQSFLGALDPNAAD"
     MNDSAPHGTS DFVVVANRLP VDMETLDDGT TRWKRSPGGL VTALEPILLG RERGSWVGWP        60
     GVPDTKVEPI VSGGVDLFPV ELSSDEVARY YEGFSNATLW PLYHDVLVAP VFDRDWWHTY       120
     LEVNRHFAEE TARTAAEGAT VWVQDYQLQL VPRLLREMRP DLTIGFFLHI PFPPVELFMQ       180
     LPWRKEIVEG LLGADLIGFH LPGGAHNFLF LARRLLGLDA TTAGVGVRGA LGTVTLDDRV       240
     VHVGAFPISV DARKLVEQAT EPAVVERAAE IRRELGNPRK ILLGVDRLDY TKGIDLRLSA       300
     LGELLDEGRL DPSDTVMVQL ATPSRERVEH YMKMRSSIEE QVSHINGDHG QIGRPVVHYL       360
     YQPVDRSELI ALFLAADVML VTPMRDGMNL VAKEYVACRA DLGGALVLSE FAGAAAELRG       420
     AYLVNPHDLD GVKNTIVAAL GQEREQGRRR MSRLHRQVLD HDVHRWAQSF LGALDPNAAD       480
//

If you have problems or comments...

PBIL Back to PBIL home page