(data stored in ACNUC7421 zone)

EMBL: AP011115.PE101

AP011115.PE101       Location/Qualifiers
FT   CDS             84249..85691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01010"
FT                   /product="putative amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48348"
FT                   /db_xref="GOA:C1AS99"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS99"
FT                   /protein_id="BAH48348.1"
FT                   /translation="MSATNPPSKSMGAGIADSSATAATADETSAEDTGRLSPTALVSLS
FT                   LASFFPAVSFAMVPFLVFTTSGTNAWQSSLLATIGVICIGRAVIAFARRYVASGSLYSY
FT                   VGEVFGPWARHLTAASLLAGFIVGVAALAAVVGVFVGSFLHARGIHGALNFDTQVIVFG
FT                   LALVLAAAVAIRGLDTSVMVAVTLAVIALPLVLIITVASAAHTGLDLGTQFSFTGFEVG
FT                   PVFQGIAVGAAFLVGFESCAALATETKDPKHSVPTAIMAVPVILGGLFPIVTILQVPGL
FT                   IATSDELAAGVSAPAALAQLSGLGHGVATATDLVLAAASFASLVGFLNYAARFTMTLSE
FT                   DGLLPSVFSRLHPKHKSPSAAVLLMTLCAFLTISGMLLWTGDIISAYTPNATLLVYMWV
FT                   VPYVIICVGAIRLSIRLREFRPGLWIAAVAGAATMTWAYTNGLVNPPPAPADSMIWVAP
FT                   VAIALLFGVVRINVSRTRHIAE"
     MSATNPPSKS MGAGIADSSA TAATADETSA EDTGRLSPTA LVSLSLASFF PAVSFAMVPF        60
     LVFTTSGTNA WQSSLLATIG VICIGRAVIA FARRYVASGS LYSYVGEVFG PWARHLTAAS       120
     LLAGFIVGVA ALAAVVGVFV GSFLHARGIH GALNFDTQVI VFGLALVLAA AVAIRGLDTS       180
     VMVAVTLAVI ALPLVLIITV ASAAHTGLDL GTQFSFTGFE VGPVFQGIAV GAAFLVGFES       240
     CAALATETKD PKHSVPTAIM AVPVILGGLF PIVTILQVPG LIATSDELAA GVSAPAALAQ       300
     LSGLGHGVAT ATDLVLAAAS FASLVGFLNY AARFTMTLSE DGLLPSVFSR LHPKHKSPSA       360
     AVLLMTLCAF LTISGMLLWT GDIISAYTPN ATLLVYMWVV PYVIICVGAI RLSIRLREFR       420
     PGLWIAAVAG AATMTWAYTN GLVNPPPAPA DSMIWVAPVA IALLFGVVRI NVSRTRHIAE       480
//

If you have problems or comments...

PBIL Back to PBIL home page