(data stored in ACNUC7421 zone)

EMBL: AP011115.PE105

AP011115.PE105       Location/Qualifiers
FT   CDS             complement(88632..89075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48352"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASA3"
FT                   /protein_id="BAH48352.1"
FT                   /translation="MTEKSESTEMLDRYCAVIRELCDAVAAHDTDHMLRYFDDSCVFVN
FT                   GVDGRHTAKDGLVEFFQQVWESFPDYAPVPVEMHLNGDVLAVIFRTTATVRVGESEQIV
FT                   SWLMTSFSTFDPETVTIVRDVYFADEEALEETIQRLHEAATVQ"
     MTEKSESTEM LDRYCAVIRE LCDAVAAHDT DHMLRYFDDS CVFVNGVDGR HTAKDGLVEF        60
     FQQVWESFPD YAPVPVEMHL NGDVLAVIFR TTATVRVGES EQIVSWLMTS FSTFDPETVT       120
     IVRDVYFADE EALEETIQRL HEAATVQ                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page