(data stored in ACNUC7421 zone)

EMBL: AP011115.PE109

AP011115.PE109       Location/Qualifiers
FT   CDS             complement(93353..93766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48356"
FT                   /db_xref="InterPro:IPR010424"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASA7"
FT                   /protein_id="BAH48356.1"
FT                   /translation="MKAASTDHETNYGEGIVVENNPQPVVAIQQDRYTFDNGPMKLELR
FT                   SARTGIDQLAGGILRFDDGGAGEPWKLPYDEMLYVITGTLRLRFADQILSLAPGEVAAI
FT                   PRGAEVVYEGEPGTTAFYALTPADWHVEHPDGL"
     MKAASTDHET NYGEGIVVEN NPQPVVAIQQ DRYTFDNGPM KLELRSARTG IDQLAGGILR        60
     FDDGGAGEPW KLPYDEMLYV ITGTLRLRFA DQILSLAPGE VAAIPRGAEV VYEGEPGTTA       120
     FYALTPADWH VEHPDGL                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page