(data stored in ACNUC7421 zone)

EMBL: AP011115.PE11

AP011115.PE11        Location/Qualifiers
FT   CDS             10019..11014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00110"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48258"
FT                   /db_xref="GOA:C1AS09"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS09"
FT                   /protein_id="BAH48258.1"
FT                   /translation="MTQPQGVVARMEHHQVAIYLAAMVAGAGIGWAAPAAGPGLEHAIN
FT                   PVLGALLFVTFLQVPVAELLRSLRDGRFLTAILAVNFVVVPLVVAAMFTFLPADQAVRI
FT                   GVLLVLLCPCVDYVIVFSGLAGGSSRRLLAATPLLLLTQMLLLPVFLVLFLGSDLSDIV
FT                   EVGPFVTAFIVLIVIPLALAWATQFWASRAESGRRTSEAATSLMVPLMAATLLVVVASQ
FT                   VPKLEGRVADVAAVVPFYVVFLVVMAFAGMLVARLFRLDPPSGRAVVFSGATRNSLVVL
FT                   PLALALPDQLAVAAVVVVTQTLVEVVGMVVYVRLVPRLLPAATDTSPAPA"
     MTQPQGVVAR MEHHQVAIYL AAMVAGAGIG WAAPAAGPGL EHAINPVLGA LLFVTFLQVP        60
     VAELLRSLRD GRFLTAILAV NFVVVPLVVA AMFTFLPADQ AVRIGVLLVL LCPCVDYVIV       120
     FSGLAGGSSR RLLAATPLLL LTQMLLLPVF LVLFLGSDLS DIVEVGPFVT AFIVLIVIPL       180
     ALAWATQFWA SRAESGRRTS EAATSLMVPL MAATLLVVVA SQVPKLEGRV ADVAAVVPFY       240
     VVFLVVMAFA GMLVARLFRL DPPSGRAVVF SGATRNSLVV LPLALALPDQ LAVAAVVVVT       300
     QTLVEVVGMV VYVRLVPRLL PAATDTSPAP A                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page