(data stored in ACNUC7421 zone)

EMBL: AP011115.PE115

AP011115.PE115       Location/Qualifiers
FT   CDS             101378..101827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48362"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASB3"
FT                   /protein_id="BAH48362.1"
FT                   /translation="MTNTENRVDTEACVERIESVCMAVVARDLEGVLDHFAEDCVFVNG
FT                   VTGTTVPGKAELVNFLNDIWASFPEYTPRPVAAHLEQTTLGMLFETTVELPATDEKASP
FT                   DGTKVRWLTSSFFTFDPTSMKIIRDVYYADEAAVEQMINEAGRAG"
     MTNTENRVDT EACVERIESV CMAVVARDLE GVLDHFAEDC VFVNGVTGTT VPGKAELVNF        60
     LNDIWASFPE YTPRPVAAHL EQTTLGMLFE TTVELPATDE KASPDGTKVR WLTSSFFTFD       120
     PTSMKIIRDV YYADEAAVEQ MINEAGRAG                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page