(data stored in ACNUC7421 zone)

EMBL: AP011115.PE117

AP011115.PE117       Location/Qualifiers
FT   CDS             complement(103043..105289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01170"
FT                   /product="putative ATP-dependent Clp protease ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01170"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48364"
FT                   /db_xref="GOA:C1ASB5"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASB5"
FT                   /protein_id="BAH48364.1"
FT                   /translation="MRSGFTTRALEALDWAQAQSIPVATRPEHVLMALLDQDATIVEPV
FT                   FEALGVDADDLRRSSPSVTVRRGAAASAAAPGIDADMASLLRAAEHEARQLSDHLVSIE
FT                   HLLIALAGRRDGVGEALRAAGADRSSMLEAVRRVRGPAAVVDAEPERTYLGVRWRPPAV
FT                   SSQVLRYSRDLTELAFRAELDPVVGRDAEIERVIQVLSRRRKNNPVLIGDPGVGKTAIA
FT                   EGLAQRIVAGDVPAALLNRRVIALDVGALVAGATYRGEFEDRVKSLLKDVVGADGGIIV
FT                   FIDELHTIVGAGAAEGAVDAGNLLKPMLARGEFRTLGATTLDEYRKHVESDGALERRFQ
FT                   PVRVDEPSSANALEMLRGLRSRYESHHGVAITDAALSAAVSLSDRYIADRFLPDKAIDL
FT                   IDEACSRRRIQSDSLSSVTRGAGSCTPPLVDDDDIARLVGQWTGIPVSRLQEEELERLV
FT                   HMEHRLAERVVGQAKAVVGVSAALRNSRTGLSDPNRPIASLMFCGPLGVGKTYLARVLA
FT                   DVMLDSGEALVQLDMSDYAEKHSVTRLVGASPGYVGYEEGGQLTDAVRRRPYCVVLLDD
FT                   IEQAHPDVHGLLRQVIDDGSLTDGQGRVVSFRHVILVMTSSLPDLGAVNQHFRAEFLTR
FT                   LDDVLEFAPLRRKDLEQLVDIQVRSVAARLSDRGIALELTHEARALIAELGDDSRQGAR
FT                   PLVRVVQKELISAVSRSILLGDACPGDTIRVDQEGTSVTLTVLSRPAEAVPQLS"
     MRSGFTTRAL EALDWAQAQS IPVATRPEHV LMALLDQDAT IVEPVFEALG VDADDLRRSS        60
     PSVTVRRGAA ASAAAPGIDA DMASLLRAAE HEARQLSDHL VSIEHLLIAL AGRRDGVGEA       120
     LRAAGADRSS MLEAVRRVRG PAAVVDAEPE RTYLGVRWRP PAVSSQVLRY SRDLTELAFR       180
     AELDPVVGRD AEIERVIQVL SRRRKNNPVL IGDPGVGKTA IAEGLAQRIV AGDVPAALLN       240
     RRVIALDVGA LVAGATYRGE FEDRVKSLLK DVVGADGGII VFIDELHTIV GAGAAEGAVD       300
     AGNLLKPMLA RGEFRTLGAT TLDEYRKHVE SDGALERRFQ PVRVDEPSSA NALEMLRGLR       360
     SRYESHHGVA ITDAALSAAV SLSDRYIADR FLPDKAIDLI DEACSRRRIQ SDSLSSVTRG       420
     AGSCTPPLVD DDDIARLVGQ WTGIPVSRLQ EEELERLVHM EHRLAERVVG QAKAVVGVSA       480
     ALRNSRTGLS DPNRPIASLM FCGPLGVGKT YLARVLADVM LDSGEALVQL DMSDYAEKHS       540
     VTRLVGASPG YVGYEEGGQL TDAVRRRPYC VVLLDDIEQA HPDVHGLLRQ VIDDGSLTDG       600
     QGRVVSFRHV ILVMTSSLPD LGAVNQHFRA EFLTRLDDVL EFAPLRRKDL EQLVDIQVRS       660
     VAARLSDRGI ALELTHEARA LIAELGDDSR QGARPLVRVV QKELISAVSR SILLGDACPG       720
     DTIRVDQEGT SVTLTVLSRP AEAVPQLS                                          748
//

If you have problems or comments...

PBIL Back to PBIL home page