(data stored in ACNUC7421 zone)

EMBL: AP011115.PE12

AP011115.PE12        Location/Qualifiers
FT   CDS             11115..11645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48259"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS10"
FT                   /protein_id="BAH48259.1"
FT                   /translation="MPEKQPVDRAEIAADLDRARRTLHELLDHATAADFERRSNGTRWT
FT                   NEQLLFHMVFGYMVVRRLLVLVRVFSRLPDRVGRGFARALDATTPVFHQINYLGSCAAA
FT                   TVFDRRRMGRHCDRVIAKLQRSLAKESETNLRRSMAFPVRWDPFFDEVMTAEQVYRYPG
FT                   KHFDFHRDQLTLG"
     MPEKQPVDRA EIAADLDRAR RTLHELLDHA TAADFERRSN GTRWTNEQLL FHMVFGYMVV        60
     RRLLVLVRVF SRLPDRVGRG FARALDATTP VFHQINYLGS CAAATVFDRR RMGRHCDRVI       120
     AKLQRSLAKE SETNLRRSMA FPVRWDPFFD EVMTAEQVYR YPGKHFDFHR DQLTLG           176
//

If you have problems or comments...

PBIL Back to PBIL home page