(data stored in ACNUC7421 zone)

EMBL: AP011115.PE120

AP011115.PE120       Location/Qualifiers
FT   CDS             complement(107521..107991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48367"
FT                   /db_xref="GOA:C1ASB8"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASB8"
FT                   /protein_id="BAH48367.1"
FT                   /translation="MSRRESRSAILRSMKVGLDQSMRIDTWNALDDLRYDRSLLSDLVS
FT                   LRFAEAGHSVLVLGPVGVGKTHLATALGHVAIRRRMTVLCARADKLFALLRAARLDNSV
FT                   EAEMRRIATVDLLVRRFCVAAPGRHRDQRLLRVGHLAPSPQGDDRQLERGAF"
     MSRRESRSAI LRSMKVGLDQ SMRIDTWNAL DDLRYDRSLL SDLVSLRFAE AGHSVLVLGP        60
     VGVGKTHLAT ALGHVAIRRR MTVLCARADK LFALLRAARL DNSVEAEMRR IATVDLLVRR       120
     FCVAAPGRHR DQRLLRVGHL APSPQGDDRQ LERGAF                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page