(data stored in ACNUC7421 zone)

EMBL: AP011115.PE127

AP011115.PE127       Location/Qualifiers
FT   CDS             complement(114923..115267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48374"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASC5"
FT                   /protein_id="BAH48374.1"
FT                   /translation="MVARTAGFVKQVISSTLYRPDGTVETTRDPAVWTLAHRGYSGSAR
FT                   LDVWAYRTKDDALRAGARLAMDCGMDEDARCRELFDAGRWTAVMERYEELSPDGHLLRV
FT                   QAAFLQLDDE"
     MVARTAGFVK QVISSTLYRP DGTVETTRDP AVWTLAHRGY SGSARLDVWA YRTKDDALRA        60
     GARLAMDCGM DEDARCRELF DAGRWTAVME RYEELSPDGH LLRVQAAFLQ LDDE             114
//

If you have problems or comments...

PBIL Back to PBIL home page