(data stored in ACNUC7421 zone)

EMBL: AP011115.PE13

AP011115.PE13        Location/Qualifiers
FT   CDS             complement(11665..12669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00130"
FT                   /product="alkylmercury lyase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48260"
FT                   /db_xref="GOA:C1AS11"
FT                   /db_xref="InterPro:IPR004927"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS11"
FT                   /protein_id="BAH48260.1"
FT                   /translation="MRLEILQVPGCPHVALLEQRLENVLAGQQSEVEISHRVIDDPAVA
FT                   ADAGMTGSPTLLVDGADPFAAPGLVPSVSCRLYPAEGGGVGGAPSVAALRQALHAAAAD
FT                   TADEPADGRGGCCSAGTAAESPLAGLGGWRDAARPRTPAERAIHYAILRAFADRGAPPE
FT                   HAELDSVAAEFGEPGRRVLARLHTADVIRLDPAGRIASAYPFSTSPTPHRVRIGGGAGV
FT                   YAMCAVDALGMSAMLAAEVVIESADPVTGEHITVTVHGESAVATPATVVVFVGADAGHG
FT                   PSADTCCTTLNFFTDRGTARSGADEHPQVGGIVVDLADATRLGATIFGGALTT"
     MRLEILQVPG CPHVALLEQR LENVLAGQQS EVEISHRVID DPAVAADAGM TGSPTLLVDG        60
     ADPFAAPGLV PSVSCRLYPA EGGGVGGAPS VAALRQALHA AAADTADEPA DGRGGCCSAG       120
     TAAESPLAGL GGWRDAARPR TPAERAIHYA ILRAFADRGA PPEHAELDSV AAEFGEPGRR       180
     VLARLHTADV IRLDPAGRIA SAYPFSTSPT PHRVRIGGGA GVYAMCAVDA LGMSAMLAAE       240
     VVIESADPVT GEHITVTVHG ESAVATPATV VVFVGADAGH GPSADTCCTT LNFFTDRGTA       300
     RSGADEHPQV GGIVVDLADA TRLGATIFGG ALTT                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page