(data stored in ACNUC7421 zone)

EMBL: AP011115.PE130

AP011115.PE130       Location/Qualifiers
FT   CDS             116454..116879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48377"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASC8"
FT                   /protein_id="BAH48377.1"
FT                   /translation="MHDRLPLTRNTDLMLELVRITSYPSGLAVQLALTATGRPARRAWH
FT                   ETRPLTDPTDLSAHWSYLEVWAGSGDLAAADPYFPRPDLQAAASGICSYRSEPLYWLPT
FT                   APAWALTLATGWPQIGLPTAVTTMHLDPITPPTSRRA"
     MHDRLPLTRN TDLMLELVRI TSYPSGLAVQ LALTATGRPA RRAWHETRPL TDPTDLSAHW        60
     SYLEVWAGSG DLAAADPYFP RPDLQAAASG ICSYRSEPLY WLPTAPAWAL TLATGWPQIG       120
     LPTAVTTMHL DPITPPTSRR A                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page