(data stored in ACNUC7421 zone)

EMBL: AP011115.PE131

AP011115.PE131       Location/Qualifiers
FT   CDS             117247..119745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48378"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASC9"
FT                   /protein_id="BAH48378.1"
FT                   /translation="MRRYHRSVTDPTDPTAEAAMSLLREHGPLHPDEWARRLVAEGHGY
FT                   LADMEELTEYIGHPRLGYLADGRSAALDALLDGRVLTHRLTEMEISSGILDANPDLMPL
FT                   LPFDDDDPAAGGLRILFRDLDDDVFDERGALDADWPADAALLLEPDALTGLRPGDLVAL
FT                   TFTGGVLRLTAAENPPAPAPDLTAALTGLVTEDRPEPLDGVIWQLMADDPSLLTAPTTP
FT                   LGELITAAGYVCDGDDIAAAGFDFAAHRGKAHMATVAAAHHLTDDQTDAVLAFLALIGV
FT                   LERTPDDQRAAAVDAVAANFGDRFAGLAHPNAARAAFGEAYATAHAGTDTLRSAAAVLR
FT                   DRGPRRIAPTAHWLAGKAAELDGWTADAERHYERALAVDPNWDEALEALARFASDRGDA
FT                   VRAIGLLDRVEGAYREPMYDLLQSFLPVDRPDLGRNDRCWCGSGRKYKACHLGTAEHSL
FT                   EQRAGWLYQKAGSFAQGIEWRPLLLSLAQIRSVHNDDPFALYHALDDPLVADVVMFECG
FT                   AFARFVAERGVLLPADELLLAQQWSLTERSVHEVETVRPGEGLTLRDVRTGDRHEVTER
FT                   TASRQLRVGDFFCARVVPAGSTTQIFGGIEPIAPGQRGQLIELLDSNATDPEELVEFLS
FT                   ARFAPPRLITPDGHPMVACRAVFEIADTTGIRRKLSRRFGAADNDRWTWTEQNSVLGVL
FT                   TLTRSTDRWELEAEAMNEPRFESLIDAVRAADPGGRLREQTRTPAAELIAQTQDNGAHP
FT                   HQPVDPEDPEIAATLDEHIRRYEQQWLDEAIPALGGHTPRQCAADPTRRDELIRLLDSF
FT                   PQQDRPGAMSAHRLREALGL"
     MRRYHRSVTD PTDPTAEAAM SLLREHGPLH PDEWARRLVA EGHGYLADME ELTEYIGHPR        60
     LGYLADGRSA ALDALLDGRV LTHRLTEMEI SSGILDANPD LMPLLPFDDD DPAAGGLRIL       120
     FRDLDDDVFD ERGALDADWP ADAALLLEPD ALTGLRPGDL VALTFTGGVL RLTAAENPPA       180
     PAPDLTAALT GLVTEDRPEP LDGVIWQLMA DDPSLLTAPT TPLGELITAA GYVCDGDDIA       240
     AAGFDFAAHR GKAHMATVAA AHHLTDDQTD AVLAFLALIG VLERTPDDQR AAAVDAVAAN       300
     FGDRFAGLAH PNAARAAFGE AYATAHAGTD TLRSAAAVLR DRGPRRIAPT AHWLAGKAAE       360
     LDGWTADAER HYERALAVDP NWDEALEALA RFASDRGDAV RAIGLLDRVE GAYREPMYDL       420
     LQSFLPVDRP DLGRNDRCWC GSGRKYKACH LGTAEHSLEQ RAGWLYQKAG SFAQGIEWRP       480
     LLLSLAQIRS VHNDDPFALY HALDDPLVAD VVMFECGAFA RFVAERGVLL PADELLLAQQ       540
     WSLTERSVHE VETVRPGEGL TLRDVRTGDR HEVTERTASR QLRVGDFFCA RVVPAGSTTQ       600
     IFGGIEPIAP GQRGQLIELL DSNATDPEEL VEFLSARFAP PRLITPDGHP MVACRAVFEI       660
     ADTTGIRRKL SRRFGAADND RWTWTEQNSV LGVLTLTRST DRWELEAEAM NEPRFESLID       720
     AVRAADPGGR LREQTRTPAA ELIAQTQDNG AHPHQPVDPE DPEIAATLDE HIRRYEQQWL       780
     DEAIPALGGH TPRQCAADPT RRDELIRLLD SFPQQDRPGA MSAHRLREAL GL               832
//

If you have problems or comments...

PBIL Back to PBIL home page