(data stored in ACNUC7421 zone)

EMBL: AP011115.PE137

AP011115.PE137       Location/Qualifiers
FT   CDS             126384..126932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48384"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASD5"
FT                   /protein_id="BAH48384.1"
FT                   /translation="MRITDSARKHHISNTDITHAFENAIRYAEYEDDGEERLLIIGTDT
FT                   AGRLLEPVAAPAGEPNRRVRAAIAAAASETTREGGRQPHCHTPHPLTPRRRRPGTEAGR
FT                   LLRGGTKIRGAAGGAGAGSLRHNGLRARHGQRQGFSTAWGPWQRRGRPRYLARPTIARC
FT                   GAVRGLEPATSTPDLRLAD"
     MRITDSARKH HISNTDITHA FENAIRYAEY EDDGEERLLI IGTDTAGRLL EPVAAPAGEP        60
     NRRVRAAIAA AASETTREGG RQPHCHTPHP LTPRRRRPGT EAGRLLRGGT KIRGAAGGAG       120
     AGSLRHNGLR ARHGQRQGFS TAWGPWQRRG RPRYLARPTI ARCGAVRGLE PATSTPDLRL       180
     AD                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page