(data stored in ACNUC7421 zone)

EMBL: AP011115.PE141

AP011115.PE141       Location/Qualifiers
FT   CDS             complement(128075..128374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01410"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48388"
FT                   /db_xref="GOA:C1ASD9"
FT                   /db_xref="InterPro:IPR022703"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASD9"
FT                   /protein_id="BAH48388.1"
FT                   /translation="MFVMLGLPSSGGTIPLEATPSLYRWLGGFEPMHQIYRGVRAIIFF
FT                   GASGAAGLIHAVWMTFAGLVIGLVVGAVITRFYDRKGLHRRLEAQAPVPVEARS"
     MFVMLGLPSS GGTIPLEATP SLYRWLGGFE PMHQIYRGVR AIIFFGASGA AGLIHAVWMT        60
     FAGLVIGLVV GAVITRFYDR KGLHRRLEAQ APVPVEARS                               99
//

If you have problems or comments...

PBIL Back to PBIL home page