(data stored in ACNUC7421 zone)

EMBL: AP011115.PE142

AP011115.PE142       Location/Qualifiers
FT   CDS             complement(128365..129435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01420"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48389"
FT                   /db_xref="GOA:C1ASE0"
FT                   /db_xref="InterPro:IPR022703"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASE0"
FT                   /protein_id="BAH48389.1"
FT                   /translation="MARTGGSGTDDPVVNRSAWSVLRTPRLVMAPVVLVCIVMSLLAVL
FT                   YMGAMLDPTKHLHHFPIALVDQDEGDTVPGSDPPVQRKLGDQIAAGLIDGVDPEKIQFR
FT                   RMGIVEARSLLDDGKIYGAIGIPSDFTKRTFVLAQASVVPGDVDRPVITVYTNPRAGTI
FT                   SANIVRAVGATALDEANRALGEQLTAQVNEQLAAGGGGTQLSGASRLVLADPIDVRTVA
FT                   HNPLPFGTGFGLAAFYYALLLVLAGFTGANLVNALVDGMLGFTPTEVGPLYLYRAAVPI
FT                   SRFHTLLVKWAIVVALGMIVSGLYLGIGSALGLPVTDPLALWGYGAFAIAAVGITAVSV
FT                   VAAIGNLGLLAICSCS"
     MARTGGSGTD DPVVNRSAWS VLRTPRLVMA PVVLVCIVMS LLAVLYMGAM LDPTKHLHHF        60
     PIALVDQDEG DTVPGSDPPV QRKLGDQIAA GLIDGVDPEK IQFRRMGIVE ARSLLDDGKI       120
     YGAIGIPSDF TKRTFVLAQA SVVPGDVDRP VITVYTNPRA GTISANIVRA VGATALDEAN       180
     RALGEQLTAQ VNEQLAAGGG GTQLSGASRL VLADPIDVRT VAHNPLPFGT GFGLAAFYYA       240
     LLLVLAGFTG ANLVNALVDG MLGFTPTEVG PLYLYRAAVP ISRFHTLLVK WAIVVALGMI       300
     VSGLYLGIGS ALGLPVTDPL ALWGYGAFAI AAVGITAVSV VAAIGNLGLL AICSCS           356
//

If you have problems or comments...

PBIL Back to PBIL home page