(data stored in ACNUC7421 zone)

EMBL: AP011115.PE145

AP011115.PE145       Location/Qualifiers
FT   CDS             130357..131244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01450"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48392"
FT                   /db_xref="InterPro:IPR018306"
FT                   /db_xref="InterPro:IPR025280"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASE3"
FT                   /protein_id="BAH48392.1"
FT                   /translation="MFSSNNSLANGRKKTADLSKLMLRAYNAEADICVRTLRAGNLTTA
FT                   ITRLNKAATTITKLGAMMDMHLADTYHALRIRELELTADYLMKAQEEKEAARAEREHLR
FT                   EERKVEQELAAQREKLDNERAHYRKVLTSIGGTDPQEKQRILDKIADLDKAIEDNDHRQ
FT                   ANIRAGYVYVISNQGAFGPNVVKIGMTRRLDPTDRVRELGSASVPFPFDTHALYFSDDA
FT                   ITLENKLHNAFTGQRLNHANPRREFFFATPAQVRDVLAAHVGNLLEYTETPEATQYFQS
FT                   RSNWPAGAAIGPTT"
     MFSSNNSLAN GRKKTADLSK LMLRAYNAEA DICVRTLRAG NLTTAITRLN KAATTITKLG        60
     AMMDMHLADT YHALRIRELE LTADYLMKAQ EEKEAARAER EHLREERKVE QELAAQREKL       120
     DNERAHYRKV LTSIGGTDPQ EKQRILDKIA DLDKAIEDND HRQANIRAGY VYVISNQGAF       180
     GPNVVKIGMT RRLDPTDRVR ELGSASVPFP FDTHALYFSD DAITLENKLH NAFTGQRLNH       240
     ANPRREFFFA TPAQVRDVLA AHVGNLLEYT ETPEATQYFQ SRSNWPAGAA IGPTT            295
//

If you have problems or comments...

PBIL Back to PBIL home page