(data stored in ACNUC7421 zone)

EMBL: AP011115.PE146

AP011115.PE146       Location/Qualifiers
FT   CDS             complement(131307..131858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01460"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48393"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASE4"
FT                   /protein_id="BAH48393.1"
FT                   /translation="MTFTVLYDANVLYPNVLRDVLIRLAQTGLVHARWTDRILNETFEN
FT                   LAEDRPDIPAATLTKLRELMNRAVPDCLVTGYEKLIPALTLPDADDRHVLAAAIRAGAQ
FT                   VIVTANLRDFPDAELAQFGIEAKHPDEFVMDLFHLDGVRVHQAVSATAAAWRNPPGTPA
FT                   DVCDRLAAAGLPISAAALRR"
     MTFTVLYDAN VLYPNVLRDV LIRLAQTGLV HARWTDRILN ETFENLAEDR PDIPAATLTK        60
     LRELMNRAVP DCLVTGYEKL IPALTLPDAD DRHVLAAAIR AGAQVIVTAN LRDFPDAELA       120
     QFGIEAKHPD EFVMDLFHLD GVRVHQAVSA TAAAWRNPPG TPADVCDRLA AAGLPISAAA       180
     LRR                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page