(data stored in ACNUC7421 zone)

EMBL: AP011115.PE147

AP011115.PE147       Location/Qualifiers
FT   CDS             complement(131860..132300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01470"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48394"
FT                   /db_xref="GOA:C1ASE5"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASE5"
FT                   /protein_id="BAH48394.1"
FT                   /translation="MMAAAHDQPTVVEQEQARQALQLLRDVDPAGETLDVTVAGTSESV
FT                   HLPRAALDLIREVLANMAAGQGVTVVPAHAELTTQQAAQMLNVSRPHVIKLLDEGHIEY
FT                   RMVGRHRRILTSSLLAYQRTQLGASRAAADELAALTEDLGLY"
     MMAAAHDQPT VVEQEQARQA LQLLRDVDPA GETLDVTVAG TSESVHLPRA ALDLIREVLA        60
     NMAAGQGVTV VPAHAELTTQ QAAQMLNVSR PHVIKLLDEG HIEYRMVGRH RRILTSSLLA       120
     YQRTQLGASR AAADELAALT EDLGLY                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page