(data stored in ACNUC7421 zone)

EMBL: AP011115.PE148

AP011115.PE148       Location/Qualifiers
FT   CDS             132429..132776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48395"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASE6"
FT                   /protein_id="BAH48395.1"
FT                   /translation="MKKTTLAMAALAISALLSGCRWRHAVQQHIDHHHGIGGPAGRRIE
FT                   RTAHDHHGPAPTTATAALPVTRSAAVAPPITPVTPTTTVAVAPPPAPAVIPANPRRRST
FT                   PSRISESVHSR"
     MKKTTLAMAA LAISALLSGC RWRHAVQQHI DHHHGIGGPA GRRIERTAHD HHGPAPTTAT        60
     AALPVTRSAA VAPPITPVTP TTTVAVAPPP APAVIPANPR RRSTPSRISE SVHSR            115
//

If you have problems or comments...

PBIL Back to PBIL home page