(data stored in ACNUC7421 zone)

EMBL: AP011115.PE149

AP011115.PE149       Location/Qualifiers
FT   CDS             complement(133005..133856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01490"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48396"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASE7"
FT                   /protein_id="BAH48396.1"
FT                   /translation="MDNPRHWVGHLRVLSGIQDRIGGFTEFVPLPFVHQSAPLYLAGAS
FT                   RPGPTNRDNRAVHALARIMLHGRIPNIQTSWVKLGVTGTQVMLQGGANDLGGTLMEETI
FT                   SRMAGSEHGSEKTVEELRAIAEGIGRPARETHHHTRPPAPPPRAVMSTIGVDGYAVVVP
FT                   IRSLRMAKSRLRTSDTMRSQLALAFFLDTITALERKHRGGADRGGLRRRHHPGVGAGAL
FT                   RRPDGRRNGPPRRNQSRHRKAPKDKPFRAGGRRPPGTALCDRWRVRHASRLCTRTPAGL
FT                   PG"
     MDNPRHWVGH LRVLSGIQDR IGGFTEFVPL PFVHQSAPLY LAGASRPGPT NRDNRAVHAL        60
     ARIMLHGRIP NIQTSWVKLG VTGTQVMLQG GANDLGGTLM EETISRMAGS EHGSEKTVEE       120
     LRAIAEGIGR PARETHHHTR PPAPPPRAVM STIGVDGYAV VVPIRSLRMA KSRLRTSDTM       180
     RSQLALAFFL DTITALERKH RGGADRGGLR RRHHPGVGAG ALRRPDGRRN GPPRRNQSRH       240
     RKAPKDKPFR AGGRRPPGTA LCDRWRVRHA SRLCTRTPAG LPG                         283
//

If you have problems or comments...

PBIL Back to PBIL home page