(data stored in ACNUC7421 zone)

EMBL: AP011115.PE153

AP011115.PE153       Location/Qualifiers
FT   CDS             complement(135730..136125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01530"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48400"
FT                   /db_xref="InterPro:IPR018727"
FT                   /db_xref="InterPro:IPR038282"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASF1"
FT                   /protein_id="BAH48400.1"
FT                   /translation="MMDDTEFLSRVREYGEYDSLGQATRVTTVVLRKLGARLTPGKVRA
FT                   LAAQLPPLARNALGPIEDGRSAPDFGVEEFRHRIAQALDAHPATAEWDTSAVLATVAQA
FT                   VDDDCLRAVLGSLPEGFAPLFGRPETV"
     MMDDTEFLSR VREYGEYDSL GQATRVTTVV LRKLGARLTP GKVRALAAQL PPLARNALGP        60
     IEDGRSAPDF GVEEFRHRIA QALDAHPATA EWDTSAVLAT VAQAVDDDCL RAVLGSLPEG       120
     FAPLFGRPET V                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page