(data stored in ACNUC7421 zone)

EMBL: AP011115.PE154

AP011115.PE154       Location/Qualifiers
FT   CDS             complement(136349..136537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48401"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASF2"
FT                   /protein_id="BAH48401.1"
FT                   /translation="MTDETLVALKNYEYLILEHGCENVSLVWHTDSVVFGDDGWADIDM
FT                   LTQPGFTPATECFAHRD"
     MTDETLVALK NYEYLILEHG CENVSLVWHT DSVVFGDDGW ADIDMLTQPG FTPATECFAH        60
     RD                                                                       62
//

If you have problems or comments...

PBIL Back to PBIL home page