(data stored in ACNUC7421 zone)

EMBL: AP011115.PE158

AP011115.PE158       Location/Qualifiers
FT   CDS             complement(140844..141416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01580"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48405"
FT                   /db_xref="GOA:C1ASF6"
FT                   /db_xref="InterPro:IPR025492"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASF6"
FT                   /protein_id="BAH48405.1"
FT                   /translation="MISTQPAQRGSRSPPRFRRRPCWWGRCSWWSGCSGSSPGVTTDYD
FT                   TLTFAGHHTEAALLGIFQVSVLHNIVHLLFGVAGIAAARTAGAAKGFLVGGGLIYLVLW
FT                   IYGLVIDQDGSAYFVPVNTADNWLHLVLGAGMVVLGLLLPRLRTTAPRLIPPPLPGRGA
FT                   VALRLSVAGPGGAGVESGGLLGLVVGA"
     MISTQPAQRG SRSPPRFRRR PCWWGRCSWW SGCSGSSPGV TTDYDTLTFA GHHTEAALLG        60
     IFQVSVLHNI VHLLFGVAGI AAARTAGAAK GFLVGGGLIY LVLWIYGLVI DQDGSAYFVP       120
     VNTADNWLHL VLGAGMVVLG LLLPRLRTTA PRLIPPPLPG RGAVALRLSV AGPGGAGVES       180
     GGLLGLVVGA                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page