(data stored in ACNUC7421 zone)

EMBL: AP011115.PE160

AP011115.PE160       Location/Qualifiers
FT   CDS             142211..142708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48407"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASF8"
FT                   /protein_id="BAH48407.1"
FT                   /translation="MRPRPAPRGRFDIAADGCMVPRMKDVSTMSSGVGAGDNPDSSAYV
FT                   FAVARALSAETIRRWDEVTFDAVVVLSKQSRYCSGRRILLAWNHHFGWSLGIEGQGPDR
FT                   VLIIGGLGLGRQPLPECIADRADEVITDLLHLECRSPERFPVPTVVHRRGAGPADHRPP
FT                   LR"
     MRPRPAPRGR FDIAADGCMV PRMKDVSTMS SGVGAGDNPD SSAYVFAVAR ALSAETIRRW        60
     DEVTFDAVVV LSKQSRYCSG RRILLAWNHH FGWSLGIEGQ GPDRVLIIGG LGLGRQPLPE       120
     CIADRADEVI TDLLHLECRS PERFPVPTVV HRRGAGPADH RPPLR                       165
//

If you have problems or comments...

PBIL Back to PBIL home page