(data stored in ACNUC7421 zone)

EMBL: AP011115.PE161

AP011115.PE161       Location/Qualifiers
FT   CDS             complement(142845..143081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48408"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASF9"
FT                   /protein_id="BAH48408.1"
FT                   /translation="MSVGVAVIPGSPTPREQVLRPGGRPSDVWSGLLDQQQDILGVLER
FT                   LHPGCPGRHAWAQVVGDRPPQRLGVVEEGGWRP"
     MSVGVAVIPG SPTPREQVLR PGGRPSDVWS GLLDQQQDIL GVLERLHPGC PGRHAWAQVV        60
     GDRPPQRLGV VEEGGWRP                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page