(data stored in ACNUC7421 zone)

EMBL: AP011115.PE162

AP011115.PE162       Location/Qualifiers
FT   CDS             complement(143425..143712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48409"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASG0"
FT                   /protein_id="BAH48409.1"
FT                   /translation="MTTSPHITTDHAEIRRWIQAHRGGPARDGTGSLRIDFLGVATGLE
FT                   HLSWKQWFTAFEDQNLALCYPQPHVHGGTSAWCELAPRTRTATGAAGSVR"
     MTTSPHITTD HAEIRRWIQA HRGGPARDGT GSLRIDFLGV ATGLEHLSWK QWFTAFEDQN        60
     LALCYPQPHV HGGTSAWCEL APRTRTATGA AGSVR                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page