(data stored in ACNUC7421 zone)

EMBL: AP011115.PE166

AP011115.PE166       Location/Qualifiers
FT   CDS             145410..145718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48413"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASG4"
FT                   /protein_id="BAH48413.1"
FT                   /translation="MTSTNPVAEVNATDTRERTERETMWPWHELDYALLVADSDRILAD
FT                   ALTPQAVVLLHRVATAPAGRARPSPPTPVGWTALPPPLPEIRATQRSPPRPEKPGKV"
     MTSTNPVAEV NATDTRERTE RETMWPWHEL DYALLVADSD RILADALTPQ AVVLLHRVAT        60
     APAGRARPSP PTPVGWTALP PPLPEIRATQ RSPPRPEKPG KV                          102
//

If you have problems or comments...

PBIL Back to PBIL home page