(data stored in ACNUC7421 zone)

EMBL: AP011115.PE167

AP011115.PE167       Location/Qualifiers
FT   CDS             146105..146512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01670"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48414"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASG5"
FT                   /protein_id="BAH48414.1"
FT                   /translation="MATERDPYRVLGLSPSASQADIASAYRRLLRRHHPDTRTRHPADP
FT                   AADEYLQQVMTAYALLRDPDHRAAHNQAEADRTEADRVDAEAIVPEPRGRRRGRAPWAA
FT                   APPLIRVVVADAPPPHPPATGLWVGPVRRHR"
     MATERDPYRV LGLSPSASQA DIASAYRRLL RRHHPDTRTR HPADPAADEY LQQVMTAYAL        60
     LRDPDHRAAH NQAEADRTEA DRVDAEAIVP EPRGRRRGRA PWAAAPPLIR VVVADAPPPH       120
     PPATGLWVGP VRRHR                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page