(data stored in ACNUC7421 zone)

EMBL: AP011115.PE168

AP011115.PE168       Location/Qualifiers
FT   CDS             complement(146930..147970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48415"
FT                   /db_xref="GOA:C1ASG6"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASG6"
FT                   /protein_id="BAH48415.1"
FT                   /translation="MSTPTTGNVASGVSATRRGLGICVTPLETRRDVILHVARRAEDLG
FT                   YDGFFLAEGWSQDAAVLLTEIATKTERITIGTGVLSVWGRTAGTLAMLATSLDQVSHGR
FT                   FVLGLGASSPQLVEGLHDQSFTAPVAKLRAVTAQVRRLLDGERVSPTTTHDHRSLRLGV
FT                   AARTGLPIYLAGLGNKSIQLAGELADGWMPFLVPRSWLPHGIDLLQQAGARSGHTTRPL
FT                   VCPAVPTAVAADQAKAHEIASWWIAFYLTSMGSLYRRSLSERGYHHQVEAVLASNPTHD
FT                   TTDVPAAAHALLDELTVWGTPDTAHDHLQRWYTAGAETPILTLTLPPHRTTAELDYMLE
FT                   TMRPHP"
     MSTPTTGNVA SGVSATRRGL GICVTPLETR RDVILHVARR AEDLGYDGFF LAEGWSQDAA        60
     VLLTEIATKT ERITIGTGVL SVWGRTAGTL AMLATSLDQV SHGRFVLGLG ASSPQLVEGL       120
     HDQSFTAPVA KLRAVTAQVR RLLDGERVSP TTTHDHRSLR LGVAARTGLP IYLAGLGNKS       180
     IQLAGELADG WMPFLVPRSW LPHGIDLLQQ AGARSGHTTR PLVCPAVPTA VAADQAKAHE       240
     IASWWIAFYL TSMGSLYRRS LSERGYHHQV EAVLASNPTH DTTDVPAAAH ALLDELTVWG       300
     TPDTAHDHLQ RWYTAGAETP ILTLTLPPHR TTAELDYMLE TMRPHP                      346
//

If you have problems or comments...

PBIL Back to PBIL home page