(data stored in ACNUC7421 zone)

EMBL: AP011115.PE172

AP011115.PE172       Location/Qualifiers
FT   CDS             complement(150240..151577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01720"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48419"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASH0"
FT                   /protein_id="BAH48419.1"
FT                   /translation="MTTRIGHRAVVLGASIAGLLAARVLSEAYAQVIVVDHDHLPGTAA
FT                   PRRCVPQARHTHVLIERGQQVLEELFPGFTDDLAARGVPTLDNLRDVRWCLSGHRFPQP
FT                   ESGMTVVSASRSYLEGCVRARVSELPGVTLVDCCDAAGLTMTPDRRRVTGVRVLRRADG
FT                   SAEEVLDADLVVDATGRGSRAPTWLAELGFESPEEEKLQVGLGYTTQIYRAPAPGLGND
FT                   LGVVIGPTPDAPRGGALQLLEGNRFLVTLMGMLGDYPPTDPDGFLDFARTLPIPDLCDV
FT                   IRDAEPLERARSFRFPASVRRRYERLSRFPAGFLVTGDALCSFNPIYAQGMTVAALEAI
FT                   TLRRHLQRATEPHPRTFFRDVAKMIDVPWDMSVGADLAFPDVIGARSPKMRIANAYIPR
FT                   LHAAAAHDPVLATTFIRVAALVDRPERLMSPGTVLRVLRQILPRPR"
     MTTRIGHRAV VLGASIAGLL AARVLSEAYA QVIVVDHDHL PGTAAPRRCV PQARHTHVLI        60
     ERGQQVLEEL FPGFTDDLAA RGVPTLDNLR DVRWCLSGHR FPQPESGMTV VSASRSYLEG       120
     CVRARVSELP GVTLVDCCDA AGLTMTPDRR RVTGVRVLRR ADGSAEEVLD ADLVVDATGR       180
     GSRAPTWLAE LGFESPEEEK LQVGLGYTTQ IYRAPAPGLG NDLGVVIGPT PDAPRGGALQ       240
     LLEGNRFLVT LMGMLGDYPP TDPDGFLDFA RTLPIPDLCD VIRDAEPLER ARSFRFPASV       300
     RRRYERLSRF PAGFLVTGDA LCSFNPIYAQ GMTVAALEAI TLRRHLQRAT EPHPRTFFRD       360
     VAKMIDVPWD MSVGADLAFP DVIGARSPKM RIANAYIPRL HAAAAHDPVL ATTFIRVAAL       420
     VDRPERLMSP GTVLRVLRQI LPRPR                                             445
//

If you have problems or comments...

PBIL Back to PBIL home page