(data stored in ACNUC7421 zone)

EMBL: AP011115.PE173

AP011115.PE173       Location/Qualifiers
FT   CDS             complement(151668..153749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01730"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASH1"
FT                   /protein_id="BAH48420.1"
FT                   /translation="MEGTGPSSIPLGDLLNSRRRRTYVGREGERELVRARLESADPQWS
FT                   VLYLHGPGGIGKTALLDVLAEIAEDVGATVVRLDGRDLSPSPSAILAALSDAVEVPVTG
FT                   VITSTEERLCVLVDSYEVLGPIDEWMRTRLLPRLPATALTVIAARTPPSPQWRADAAWS
FT                   ALLRVVSLRNLTPGECREFLRAVAVSTQLHDRICQVTHGHPLALSLLADVASRGGEVAA
FT                   DPLTPDLIGVLMQRFIEVVPSPVHRRALEVCALARVTTESLLRDVLELDDAHEVFAWLR
FT                   QLSFVEAGPEGLFPHDLARDVVDVDLRWRDLDFYTEVFHRVWRHLRRRLTSCSGREQQR
FT                   VIFDLKFVFRNLPGVLSPVDWESWGHHYPEPACEEDRETIVELVRSHEGAESAEIAAAW
FT                   FRRQPEGFYIVRRPDGTARGFFGLLDLSRASADDIAADPGAAAAWDFARTQSPPREGEA
FT                   ITQTRFVIDATAYQDPSPTLNAIPIMTMQRYLCTPRLSWDFLTLAEPDRWNEYFAVADL
FT                   PRAGGADFEVGARRYGLFSHDFRRVPVDAWFEQVAVRALSDNPVAPKRPAPQLLVLSQP
FT                   EFEQAVRQALHDWRRPDLLRRNPLMRTRVVCDRGGAEPDVAELDTVLRDAVDALADDPR
FT                   DDKMVRAVDRTYLRPAATQEAAAQILGLPFSTYRRHLTQGVAQVVSWLWDREIYGRHE"
     MEGTGPSSIP LGDLLNSRRR RTYVGREGER ELVRARLESA DPQWSVLYLH GPGGIGKTAL        60
     LDVLAEIAED VGATVVRLDG RDLSPSPSAI LAALSDAVEV PVTGVITSTE ERLCVLVDSY       120
     EVLGPIDEWM RTRLLPRLPA TALTVIAART PPSPQWRADA AWSALLRVVS LRNLTPGECR       180
     EFLRAVAVST QLHDRICQVT HGHPLALSLL ADVASRGGEV AADPLTPDLI GVLMQRFIEV       240
     VPSPVHRRAL EVCALARVTT ESLLRDVLEL DDAHEVFAWL RQLSFVEAGP EGLFPHDLAR       300
     DVVDVDLRWR DLDFYTEVFH RVWRHLRRRL TSCSGREQQR VIFDLKFVFR NLPGVLSPVD       360
     WESWGHHYPE PACEEDRETI VELVRSHEGA ESAEIAAAWF RRQPEGFYIV RRPDGTARGF       420
     FGLLDLSRAS ADDIAADPGA AAAWDFARTQ SPPREGEAIT QTRFVIDATA YQDPSPTLNA       480
     IPIMTMQRYL CTPRLSWDFL TLAEPDRWNE YFAVADLPRA GGADFEVGAR RYGLFSHDFR       540
     RVPVDAWFEQ VAVRALSDNP VAPKRPAPQL LVLSQPEFEQ AVRQALHDWR RPDLLRRNPL       600
     MRTRVVCDRG GAEPDVAELD TVLRDAVDAL ADDPRDDKMV RAVDRTYLRP AATQEAAAQI       660
     LGLPFSTYRR HLTQGVAQVV SWLWDREIYG RHE                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page